PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890295.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 534aa    MW: 60178.6 Da    PI: 6.8266
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890295.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS322.68.2e-991114593340
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     e Lle A a+++++ +++q+l++ l+el+sp+gd+ q+laayf++AL +r+++s++++y++l + ++++ + +++ +++  f+evsP+ +f+h++
  XP_015890295.1 111 EILLETAGAIADKNSARVQQLMWMLNELSSPYGDSDQKLAAYFLQALFSRMTDSGERCYRTLISASEKTCSFESTRKMVLKFQEVSPWTTFGHVA 205
                     679**********************************************************96655554444444444455************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...........skeeleetgerLakfAeelgvpfefnvl 181
                     +N aI+ea+ege ++HiiD++ ++++QWp+Ll+aLa+R++++p+lR+T+v+s++++            ++ ++e+g r++kfA+ +gvpf+fnv+
  XP_015890295.1 206 CNGAIMEAFEGEAKLHIIDISNTYCTQWPTLLEALATRTDETPHLRLTTVVSSKASggggvggsvgaVQKVMREIGTRMEKFARLMGVPFKFNVI 300
                     **************************************************99887799*******99999************************* PP

            GRAS 182 vak.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse....sFlerflealeyysalfdsl 271
                     +++ +l++l+l++L++k++Eala+n+v +lh++     +++++rd +++++++l+P++++vve+ead++ +    +F+++f e+l+++ + f+sl
  XP_015890295.1 301 HHSgELSELKLSDLDIKEDEALAINCVGALHTVT----AVNNRRDYFISAFRNLRPRIITVVEEEADLDVGvdgiDFVKGFQECLRWFRVYFESL 391
                     8888*****************************8....888899*********************99865556669******************* PP

            GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                     ++++pr+s+er ++Er+  gr+iv++vac+ +e++er+et+ +W++rl+ +G++pv++s+++ ++++  
  XP_015890295.1 392 DESFPRTSNERLMLERA-AGRAIVDLVACSPSESVERRETATRWSRRLHGVGYNPVTFSDEVCDDVREK 459
                     *****************.*******************************************99998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.50683473IPR005202Transcription factor GRAS
PfamPF035142.9E-96111459IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MDTLFRLVSL QSDQSFNSSR TSSSSRSSRQ NINNHYHQQQ EDEECFNFFM DEEDFSSSSS  60
KHYYPPYQPH HHPSTTSTPT PTHTTTSTPT ELSFSPARDL NFEFSGKWAF EILLETAGAI  120
ADKNSARVQQ LMWMLNELSS PYGDSDQKLA AYFLQALFSR MTDSGERCYR TLISASEKTC  180
SFESTRKMVL KFQEVSPWTT FGHVACNGAI MEAFEGEAKL HIIDISNTYC TQWPTLLEAL  240
ATRTDETPHL RLTTVVSSKA SGGGGVGGSV GAVQKVMREI GTRMEKFARL MGVPFKFNVI  300
HHSGELSELK LSDLDIKEDE ALAINCVGAL HTVTAVNNRR DYFISAFRNL RPRIITVVEE  360
EADLDVGVDG IDFVKGFQEC LRWFRVYFES LDESFPRTSN ERLMLERAAG RAIVDLVACS  420
PSESVERRET ATRWSRRLHG VGYNPVTFSD EVCDDVREKN WSNAKQNYPN SGYEPMKEGH  480
NKNAWCRSAK PSQAKPSQVG KVRGRVRHKV QVMRMGKDIV QTREAATVVV VGVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2714345037330GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890295.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLF6HSS80.0F6HSS8_VITVI; Putative uncharacterized protein
STRINGVIT_07s0129g00030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-174GRAS family protein